Antibodies

View as table Download

Rabbit Polyclonal Anti-XPNPEP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XPNPEP2 antibody: synthetic peptide directed towards the middle region of human XPNPEP2. Synthetic peptide located within the following region: QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS

XPNPEP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-240 of human XPNPEP2 (NP_003390.4).
Modifications Unmodified

XPNPEP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-240 of human XPNPEP2 (NP_003390.4).
Modifications Unmodified

Rabbit polyclonal antibody to XPNPEP2 (X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 286 and 564 of XPNPEP2 (Uniprot ID#O43895)

Rabbit polyclonal antibody to XPNPEP2 (X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound)

Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 198 and 476 of XPNPEP2 (Uniprot ID#O43895)

XPNPEP2 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human XPNPEP2

XPNPEP2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human XPNPEP2