Antibodies

Jump to Filters
View as table Download
PAG608 (ZMAT3) Rabbit Polyclonal Antibody
TA339800

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZMAT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZMAT3 antibody: synthetic peptide directed towards the N terminal of human ZMAT3. Synthetic peptide located within the following region: EQDCALEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSC
PAG608 (ZMAT3) Rabbit Polyclonal Antibody
TA350259

USD 345.00

In Stock

Rabbit Polyclonal Anti-ZMAT3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ZMAT3
ZMAT3 Rabbit Polyclonal Antibody
TA364909

USD 380.00

4 Weeks

ZMAT3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ZMAT3
PAG608 (ZMAT3) Rabbit Polyclonal Antibody
TA383503

USD 220.00

3 Weeks

ZMAT3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-289 of human ZMAT3 (NP_071915.1).
Modifications Unmodified