Antibodies

View as table Download

Rabbit Polyclonal Anti-ZNF138 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF138 antibody: synthetic peptide directed towards the middle region of human ZNF138. Synthetic peptide located within the following region: TFNWSTNLSKPKKIHTGEKPYKCEVCGKAFHQSSILTKHKIIRTGEKPYK

Rabbit Polyclonal Anti-ZNF138 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF138 antibody: synthetic peptide directed towards the N terminal of human ZNF138. Synthetic peptide located within the following region: KRHEMVVAKHSALCSRFAQDLWLEQNIKDSFQKVTLSRYGKYGHKNLQLR

Rabbit Polyclonal Anti-ZNF138 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF138 antibody: synthetic peptide directed towards the C terminal of human ZNF138. Synthetic peptide located within the following region: IHTEEKPYKCEQCGKVFKQSPTLTKHQIIYTGEEPYKCEECGKAFNLS

ZNF138 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ZNF138

ZNF138 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ZNF138