Rabbit Polyclonal Anti-OR2M4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR2M4 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2M4. Synthetic peptide located within the following region: SAFERLLVICCVVMLIFPVSVIILSYSHVLRAVIHMGSGESRRKAFTTCS |
Rabbit Polyclonal Anti-OR2S2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR2S2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2S2. Synthetic peptide located within the following region: KKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFY |
Rabbit Polyclonal Anti-OR2T12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR2T12 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2T12. Synthetic peptide located within the following region: VVSAFYTMFTPLLNPLIYSVRNSEVKEALKRWLGTCVNLKHQQNEAHRSR |
Rabbit Polyclonal Anti-OR2T12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR2T12 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2T12. Synthetic peptide located within the following region: GIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVRNSEVKEALKRW |
Rabbit Polyclonal Anti-OR2W3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR2W3 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2W3. Synthetic peptide located within the following region: IIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGALGRL |
Rabbit Polyclonal Anti-OR4A15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR4A15 antibody is: synthetic peptide directed towards the N-terminal region of Human OR4A15. Synthetic peptide located within the following region: KNNVTEFILLGLTQNPEGQKVLFVTFLLIYMVTIMGNLLIIVTIMASQSL |
Rabbit Polyclonal Anti-OR4A16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR4A16 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4A16. Synthetic peptide located within the following region: FLLISCGVILNFLKTYSQEERHKALPTCISHIIVVALVFVPCIFMYVRPV |
Rabbit Polyclonal Anti-OR4A47 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR4A47 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4A47. Synthetic peptide located within the following region: ACTIVFLLLLISYGVILHSLKNLSQKGRQKALSTCSSHMTVVVFFFVPCI |
Rabbit Polyclonal Anti-OR4C11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR4C11 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4C11. Synthetic peptide located within the following region: TTFPMDKMVAVFYTIGTPFLNPLIYTLRNAEVKNAMRKLWHGKIISENKG |
Rabbit Polyclonal Anti-OR4C16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR4C16 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4C16. Synthetic peptide located within the following region: FMYTCLATVFPMDKMIAVFYTVGTSFLNPVIYTLKNTEVKSAMRKLWSKK |
Rabbit Polyclonal Anti-OR4E2 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for Anti-OR4E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4E2. Synthetic peptide located within the following region: RPDTSFSIDKVVSVFYTVVTPLLNPFIYTLRNEEVKSAMKQLRQRQVFFT |
Rabbit Polyclonal Anti-OR4F4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR4F4 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4F4. Synthetic peptide located within the following region: PIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRRLRKWDAHSSVKF |
Rabbit Polyclonal Anti-OR4F6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR4F6 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4F6. Synthetic peptide located within the following region: FISLASFLILIISYIFILVTVQKKSSGGIFKAFSMLSAHVIVVVLVFGPL |
Rabbit Polyclonal Anti-OR4K1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR4K1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4K1. Synthetic peptide located within the following region: PFSRLPVDKFLSVFYTVCTPLLNPIIYSLRNEDVKAAMWKLRNRHVNSWK |
Rabbit Polyclonal Anti-OR4Q3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR4Q3 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4Q3. Synthetic peptide located within the following region: CVFIYLRPFCSFSVDKIFSLFYTVITPMLNPLIYTLRNTDMKTAMKKLRI |
Rabbit Polyclonal Anti-OR4X2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR4X2 antibody is: synthetic peptide directed towards the N-terminal region of Human OR4X2. Synthetic peptide located within the following region: FLVLSPNQEVQRVCFVIFLFLYTAIVLGNFLIVLTVMTSRSLGSPMYFFL |
Rabbit Polyclonal Anti-OR4L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR4L1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4L1. Synthetic peptide located within the following region: CIFIYVWPFSSLASNKTLAVFYTVITPLLNPSIYTLRNKKMQEAIRKLRF |
Rabbit Polyclonal Anti-OR4N2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR4N2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4N2. Synthetic peptide located within the following region: YTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKASMKKVFNKHIA |
Rabbit Polyclonal Anti-OR4N5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR4N5 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4N5. Synthetic peptide located within the following region: AIFIYTCPFQAFPADKVVSLFHTVIFPLMNPVIYTLRNQEVKASMRKLLS |
Rabbit Polyclonal Anti-OR5AN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5AN1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5AN1. Synthetic peptide located within the following region: LSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKDALKRLQKRKC |
Rabbit Polyclonal Anti-OR5AP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5AP2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5AP2. Synthetic peptide located within the following region: MYLRPTSSYSMEQDKVVSVFYTVIIPVLNPLIYSLKNKDVKKALKKILWK |
Rabbit Polyclonal Anti-OR9G1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR9G1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR9G1. Synthetic peptide located within the following region: ILYIYALPRSSYSFDMDKIVSTFYTVVFPMLNLMIYSLRNKDVKEALKKL |
Rabbit Polyclonal Anti-OR5B12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5B12 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5B12. Synthetic peptide located within the following region: EMVIFFVVGFNDLFSILVILISYLFIFITIMKMRSPEGRQKAFSTCASHL |
Rabbit Polyclonal Anti-OR5B17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5B17 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5B17. Synthetic peptide located within the following region: FNVFFALLVTLISYLFILITILKRHTGKGYQKPLSTCGSHLIAIFLFYIT |
Rabbit Polyclonal Anti-OR5C1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5C1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5C1. Synthetic peptide located within the following region: SSSYALDTDKMASVFYTLVIPSLNPLIYSLRNKEVKEALRQTWSRFHCPG |
Rabbit Polyclonal Anti-OR5D13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5D13 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5D13. Synthetic peptide located within the following region: YCVPNPKTSSLIVTVASVFYTVAIPMLNPLIYSLRNKDINNMFEKLVVTK |
Rabbit Polyclonal Anti-OR5D14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5D14 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5D14. Synthetic peptide located within the following region: TILFLYCVPNSKNSRQTVKVASVFYTVVNPMLNPLIYSLRNKDVKDAFWK |
Rabbit Polyclonal Anti-OR5T2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5T2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5T2. Synthetic peptide located within the following region: PSSSYASDHDMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVI |
Rabbit Polyclonal Anti-OR8D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR8D1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR8D1. Synthetic peptide located within the following region: FFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA |
Rabbit Polyclonal Anti-OR5H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5H2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5H2. Synthetic peptide located within the following region: GAHLLSVSLYYGPLIFMYLRPASPQADDQDMIDSVFYTIIIPLLNPIIYS |
Rabbit Polyclonal Anti-OR5J2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5J2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5J2. Synthetic peptide located within the following region: FSYIQPSSQYFVEQEKVVSMFYTLGIPMLNLLIHSLRNKDVKEAVKRAIE |
Rabbit Polyclonal Anti-OR5K2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5K2 antibody is: synthetic peptide directed towards the middle region of Human OR5K2. Synthetic peptide located within the following region: ILLTIFRMKSKEGRAKAFSTCASHFSSVSLFYGSIFFLYIRPNLLEEGGN |
Rabbit Polyclonal Anti-OR5L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5L2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5L2. Synthetic peptide located within the following region: YCRPSSGNSGDVDKVATVFYTVVIPMLNPLIYSLRNKDVNKALRKVMGSK |
Rabbit Polyclonal Anti-OR6C6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR6C6 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6C6. Synthetic peptide located within the following region: VSMTYGSCIFMYIKPSAKERVTVSKGVALLYTSIAPLLNPFIYTLRNQQV |
Rabbit Polyclonal Anti-OR6C6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR6C6 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6C6. Synthetic peptide located within the following region: VILSYTCIIKTILKFSSAQQRNKAFSTCTSHMIVVSMTYGSCIFMYIKPS |
Rabbit Polyclonal Anti-OR6K2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR6K2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6K2. Synthetic peptide located within the following region: AIALAFAVLSPFFNPIIYSLRNKEIKEAIKKHIGQAKIFFSVRPGTSSKI |
Rabbit Polyclonal Anti-OR6K6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR6K6 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6K6. Synthetic peptide located within the following region: TYSVFWDTAIAVTFVILAPFFNPIIYSLKNKDMKEAIGRLFHYQKRAGWA |
Rabbit Polyclonal Anti-OR6M1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR6M1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6M1. Synthetic peptide located within the following region: KINFLLSALVILSSLAFTTGSYVYIISTILRIPSTQGRQKAFSTCASHIT |
Rabbit Polyclonal Anti-OR6M1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR6M1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6M1. Synthetic peptide located within the following region: SNIFVYVRPNQNSSLDYDKVAAVLITVVTPLLNPFIYSLRNEKVQEVLRE |
Rabbit Polyclonal Anti-OR6N2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR6N2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6N2. Synthetic peptide located within the following region: KSYSLTLDRTLAIVYSVLTPMVNPIIYSLRNKEIIKAIKRTIFQKGDKAS |
Rabbit Polyclonal Anti-OR6S1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR6S1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6S1. Synthetic peptide located within the following region: AIFLYVRPSQSGSVDTNWAVTVITTFVTPLLNPFIYALRNEQVKEALKDM |
Rabbit Polyclonal Anti-OR7A17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR7A17 antibody is: synthetic peptide directed towards the C-terminal region of Human OR7A17. Synthetic peptide located within the following region: ASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTVATPMLNPFIYS |
Rabbit Polyclonal Anti-OR7G1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR7G1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR7G1. Synthetic peptide located within the following region: AFGVYISSAVAESSRITAVASVMYTVVPQMMNPFIYSLRNKEMKKALRKL |
Rabbit Polyclonal Anti-OR7G2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR7G2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR7G2. Synthetic peptide located within the following region: LGVYISSVVTDSPRKTAVASVMYSVFPQMVNPFIYSLRNKDMKGTLRKFI |
Rabbit Polyclonal Anti-OR5M10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5M10 antibody is: synthetic peptide directed towards the middle region of Human OR5M10. Synthetic peptide located within the following region: NGLSQTLLTFHLSFCGSLEINHFYCADPPLIMLACSDTRVKKMAMFVVAG |
Rabbit Polyclonal Anti-OR5M9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5M9 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5M9. Synthetic peptide located within the following region: YLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAVNKAITKT |
Rabbit Polyclonal Anti-PRKACB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACB antibody: synthetic peptide directed towards the N terminal of human PRKACB. Synthetic peptide located within the following region: MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTL |
Rabbit Polyclonal Anti-ADRBK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRBK2 antibody: synthetic peptide directed towards the N terminal of human ADRBK2. Synthetic peptide located within the following region: FCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC |
Rabbit Polyclonal Anti-OR51E1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR51E1 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human OR51E1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Gibbon, Galago (89%); Marmoset, Panda (84%). |
Rabbit Polyclonal Anti-OR51E1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR51E1 antibody was raised against synthetic 16 amino acid peptide from internal region of human OR51E1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Panda, Rabbit, Horse, Pig (100%); Galago, Bat, Elephant (94%); Opossum (88%). |
Germany
Japan
United Kingdom
China
