Germany
Japan
United Kingdom
China
Rabbit polyclonal antibody to RPL14 (ribosomal protein L14)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 135 of RPL14 (Uniprot ID#P50914) |
Antibodies
View as table Download
Goat Anti-Ribosomal Protein L19 / RPL19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-LRRYRESKKIDRH, from the internal region of the protein sequence according to NP_000972.1. |
Rabbit polyclonal anti-RPL19 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RPL19. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-RPS2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human RPS2. |
Rabbit polyclonal anti-RPL37 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL37. |
Rabbit polyclonal S6 Ribosomal Protein antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human S6 Ribosomal Protein. |
Rabbit polyclonal S6 Ribosomal Protein (Ser235) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human S6 Ribosomal protein around the phosphorylation site of serine 235 (R-L-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-RPS7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RPS7. |
Rabbit polyclonal anti-RPS8 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS8. |
Rabbit polyclonal anti-RPS21 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS21. |
Rabbit polyclonal anti-RPS25 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS25. |
Anti-RPS6 (Phospho-Ser235/236) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 235/236 (R-L-S(p)-S(p)-L-R) derived from Human S6 Ribosomal Protein. |
| Modifications | Phospho-specific |
Anti-RPS27A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit polyclonal RPS21 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RPS21 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 44-71 amino acids from the C-terminal region of human RPS21. |
Rabbit polyclonal Anti-Rpl17 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rpl17 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rpl17. Synthetic peptide located within the following region: APKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKIS |
Carrier-free (BSA/glycerol-free) MRPL13 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-RPLP0 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-RPL15 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-RPL11 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPL11 |
Rabbit Polyclonal Anti-RPLP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPLP2 |
MRPL13 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
MRPL13 mouse monoclonal antibody,clone 6A11, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
MRPL13 mouse monoclonal antibody,clone 6A11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MRPL13 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Reactivities
- Rat
Pathways
- Ribosome
Filter by
Category
Target Symbol
- RPL7A (15)
- RPL10 (11)
- RPL10A (10)
- RPS6 (9)
- MRPL13 (6)
- RPL27 (5)
- RPSA (4)
- RPL15 (3)
- RPL17 (3)
- RPS3 (3)
- RPL11 (2)
- RPL14 (2)
- RPL19 (2)
- RPL5 (2)
- RPLP0 (2)
- RPLP2 (2)
- RPS19 (2)
- RPS21 (2)
- RPS27 (2)
- RPS9 (2)
- UBA52 (2)
- FAU (1)
- RPL13A (1)
- RPL18 (1)
- RPL22 (1)
- RPL23 (1)
- RPL26L1 (1)
- RPL27A (1)
- RPL28 (1)
- RPL3 (1)
- RPL30 (1)
- RPL34 (1)
- RPL35 (1)
- RPL36 (1)
- RPL37 (1)
- RPL39 (1)
- RPL8 (1)
- RPLP1 (1)
- RPS10 (1)
- RPS11 (1)
- RPS12 (1)
- RPS13 (1)
- RPS15 (1)
- RPS18 (1)
- RPS2 (1)
- RPS20 (1)
- RPS23 (1)
- RPS25 (1)
- RPS27A (1)
- RPS4X (1)
- RPS7 (1)
- RPS8 (1)