Rabbit polyclonal antibody to RPL14 (ribosomal protein L14)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 135 of RPL14 (Uniprot ID#P50914) |
Rabbit polyclonal antibody to RPL14 (ribosomal protein L14)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 135 of RPL14 (Uniprot ID#P50914) |
Goat Anti-Ribosomal Protein L19 / RPL19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-LRRYRESKKIDRH, from the internal region of the protein sequence according to NP_000972.1. |
Rabbit polyclonal anti-RPL19 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RPL19. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-RPS2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human RPS2. |
Rabbit polyclonal anti-RPL11 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human RPL11. |
Rabbit polyclonal anti-RPL37 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL37. |
Rabbit polyclonal S6 Ribosomal Protein antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human S6 Ribosomal Protein. |
Rabbit polyclonal S6 Ribosomal Protein (Ser235) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human S6 Ribosomal protein around the phosphorylation site of serine 235 (R-L-SP-S-L). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-RPS7 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RPS7. |
Rabbit polyclonal anti-RPS8 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS8. |
Rabbit polyclonal anti-RPS21 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS21. |
Rabbit polyclonal anti-RPS25 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS25. |
Anti-RPS6 (Phospho-Ser235/236) Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 235/236 (R-L-S(p)-S(p)-L-R) derived from Human S6 Ribosomal Protein. |
Modifications | Phospho-specific |
Anti-RPS27A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit polyclonal RPS21 Antibody (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This RPS21 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 44-71 amino acids from the C-terminal region of human RPS21. |
Rabbit polyclonal Anti-Rpl17 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rpl17 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rpl17. Synthetic peptide located within the following region: APKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKIS |
Carrier-free (BSA/glycerol-free) MRPL13 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPL10 mouse monoclonal antibody, clone OTI6B11 (formerly 6B11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPL10 mouse monoclonal antibody,clone OTI9A8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPL10A mouse monoclonal antibody,clone OTI2G9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPL10A mouse monoclonal antibody,clone OTI4B2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPL27 mouse monoclonal antibody,clone OTI6D3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPSA mouse monoclonal antibody,clone OTI1G3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPL7A mouse monoclonal antibody,clone OTI4C1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPL7A mouse monoclonal antibody,clone OTI4D5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPL7A mouse monoclonal antibody,clone OTI3C5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-RPLP0 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-RPLP0 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-RPL15 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-RPL15 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-RPL11 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RPL11 |
Rabbit Polyclonal Anti-RPLP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RPLP1 |
Rabbit Polyclonal Anti-RPLP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RPLP2 |
Rabbit Polyclonal Anti-RPS3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
MRPL13 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
MRPL13 mouse monoclonal antibody,clone 6A11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MRPL13 mouse monoclonal antibody,clone 6A11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MRPL13 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPL10 mouse monoclonal antibody, clone OTI6B11 (formerly 6B11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPL10 mouse monoclonal antibody, clone OTI6B11 (formerly 6B11), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RPL10 mouse monoclonal antibody, clone OTI6B11 (formerly 6B11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPL10 mouse monoclonal antibody, clone OTI6B11 (formerly 6B11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPL10 mouse monoclonal antibody,clone OTI9A8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPL10 mouse monoclonal antibody,clone OTI9A8, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RPL10 mouse monoclonal antibody,clone OTI9A8, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPL10 mouse monoclonal antibody,clone OTI9A8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPL10A mouse monoclonal antibody,clone OTI2G9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPL10A mouse monoclonal antibody,clone OTI2G9, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RPL10A mouse monoclonal antibody,clone OTI2G9, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPL10A mouse monoclonal antibody,clone OTI2G9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |