Antibodies

Jump to Filters
View as table Download
TARSL2 (Center) Rabbit Polyclonal Antibody
AP18215PU-N

USD 450.00

2 Weeks

TARSL2 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human TARSL2
TARSL2 Rabbit Polyclonal Antibody
TA331627

USD 375.00

5 Days

Rabbit Polyclonal Anti-TARSL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TARSL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human TARSL2. Synthetic peptide located within the following region: TYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMV