TARSL2 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human TARSL2 |
TARSL2 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human TARSL2 |
Rabbit Polyclonal Anti-TARSL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TARSL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human TARSL2. Synthetic peptide located within the following region: TYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMV |