Antibodies

View as table Download

Rabbit Polyclonal Anti-HSD3B1 Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ

Rabbit polyclonal CYP17A1 Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CYP17A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-388 amino acids from the Central region of human CYP17A1.

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL

Rabbit Polyclonal Anti-HSD3B2 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD3B2 antibody: synthetic peptide directed towards the N terminal of human HSD3B2. Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN

Rabbit Polyclonal Anti-CYP21A2 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP21A2 antibody: synthetic peptide directed towards the C terminal of human CYP21A2. Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA