Antibodies

View as table Download

Rabbit Polyclonal antibody to Histamine H2 Receptor (histamine receptor H2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of Histamine H2 Receptor (Uniprot ID#P25021)

Rabbit polyclonal anti-HRH2 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HRH2.

Rabbit Polyclonal Anti-HRH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HRH2 antibody is: synthetic peptide directed towards the C-terminal region of Human HRH2. Synthetic peptide located within the following region: DFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQ

Goat Anti-Histamine Receptor H2 (aa309-323) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SHNSHKTSLRLNNS, from the internal region of the protein sequence according to NP_001124527.1; NP_071640.1.

Rabbit Polyclonal Anti-HRH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HRH2