Antibodies

Jump to Filters
View as table Download
Contactin 1 (CNTN1) Mouse Monoclonal Antibody [Clone ID: S73-20]
TA326400

USD 410.00

5 Days

Mouse monoclonal Contactin/F3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Contactin 1 (CNTN1) Goat Polyclonal Antibody
TA326749

USD 375.00

5 Days

Goat Anti-contactin 1 (aa585-870) Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-QVTSQEYSARLEN, from the internal region of the protein sequence according to NP_001834.2; NP_778203.1.
Contactin 1 (CNTN1) Goat Polyclonal Antibody
TA326307

USD 375.00

5 Days

Goat Anti-contactin 1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-ENIRGKDKHQAR, from the internal region of the protein sequence according to NP_001834.2; NP_778203.1; NP_001242992.1.
Contactin 1 (CNTN1) Rabbit Polyclonal Antibody
TA342612

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNTN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNTN1 antibody: synthetic peptide directed towards the middle region of human CNTN1. Synthetic peptide located within the following region: QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYW
Contactin 1 (CNTN1) Rabbit Polyclonal Antibody
TA342613

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNTN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNTN1 antibody: synthetic peptide directed towards the N terminal of human CNTN1. Synthetic peptide located within the following region: NGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNYGMVRSTEATL