Antibodies

View as table Download

Rabbit Polyclonal Anti-CRY2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRY2 antibody: synthetic peptide directed towards the N terminal of human CRY2. Synthetic peptide located within the following region: IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE

Carrier-free (BSA/glycerol-free) CRY2 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CRY2 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CRY2 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

CRY2 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

CRY2 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated