EPO (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 20-48 amino acids from the N-terminal region of Human Erythropoietin. |
EPO (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 20-48 amino acids from the N-terminal region of Human Erythropoietin. |
Rabbit anti-EPO Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EPO |
Rabbit Polyclonal Anti-EPO Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPO antibody: synthetic peptide directed towards the middle region of human EPO. Synthetic peptide located within the following region: KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
Rabbit Polyclonal Anti-EPO Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPO Antibody: A synthesized peptide derived from human EPO |
EPO mouse monoclonal antibody, clone Epo2
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EPO mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EPO Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EPO |
EPO mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
EPO mouse monoclonal antibody,clone OTI5D8, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
EPO mouse monoclonal antibody,clone OTI5D8, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
EPO mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".