Antibodies

Jump to Filters
View as table Download
VPS28 Rabbit Polyclonal Antibody
TA345056

USD 475.00

5 Days

Rabbit Polyclonal Anti-VPS28 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-VPS28 antibody: synthetic peptide directed towards the N terminal of human VPS28. Synthetic peptide located within the following region: MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ
VPS28 Goat Polyclonal Antibody
TA302924

USD 375.00

In Stock

Goat Polyclonal Antibody against VPS28

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ESAYNAFNRFLHA, from the C Terminus of the protein sequence according to NP_057292.1.
VPS28 Mouse Monoclonal Antibody [Clone ID: OTI1A8]
CF505691

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) VPS28 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
VPS28 Rabbit Polyclonal Antibody
TA350605

USD 345.00

In Stock

Rabbit Polyclonal Anti-VPS28 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
VPS28 Mouse Monoclonal Antibody [Clone ID: OTI1A8]
TA505691

USD 379.00

In Stock

VPS28 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
VPS28 Mouse Monoclonal Antibody [Clone ID: OTI1A8]
TA505691S

USD 159.00

In Stock

VPS28 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated