Rabbit Polyclonal Anti-DGKD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DGKD Antibody: A synthesized peptide derived from human DGKD |
Rabbit Polyclonal Anti-DGKD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DGKD Antibody: A synthesized peptide derived from human DGKD |
DGKD rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 34-88 of Human DGK-δ. |
Rabbit polyclonal anti-DGKD antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKD. |
Rabbit Polyclonal Anti-DGKD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DGKD antibody is: synthetic peptide directed towards the C-terminal region of Human DGKD. Synthetic peptide located within the following region: KRSRSGKFRLVTKFKKEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSL |