Antibodies

View as table Download

Rabbit Polyclonal TdT Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-DNTT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNTT antibody: synthetic peptide directed towards the N terminal of human DNTT. Synthetic peptide located within the following region: FQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSG

Rabbit Polyclonal Anti-DNTT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNTT antibody: synthetic peptide directed towards the middle region of human DNTT. Synthetic peptide located within the following region: LRRYATHERKMILDNHALYDKTKRIFLKAESEEEIFAHLGLDYIEPWERN