Antibodies

Jump to Filters
View as table Download
IMPA2 Rabbit Polyclonal Antibody
TA344408

USD 475.00

5 Days

Rabbit Polyclonal Anti-IMPA2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IMPA2 antibody: synthetic peptide directed towards the middle region of human IMPA2. Synthetic peptide located within the following region: RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH
IMPA2 Rabbit Polyclonal Antibody
TA308108

USD 415.00

5 Days

Rabbit polyclonal antibody to IMPA2 (inositol(myo)-1(or 4)-monophosphatase 2)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 4 and 272 of IMPA2 (Uniprot ID#O14732)