Antibodies

View as table Download

PI4KB (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Bovine, Human, Mouse, Rat, Zebrafish
Immunogen KLH conjugated synthetic peptide between 519-548 amino acids from the Center region of Human PIK4CB.

Rabbit Polyclonal Anti-PI4KB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PI4KB antibody: synthetic peptide directed towards the N terminal of human PI4KB. Synthetic peptide located within the following region: LILSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDATASISLSSN

Rabbit Polyclonal Anti-PI4KB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PI4KB antibody: synthetic peptide directed towards the middle region of human PI4KB. Synthetic peptide located within the following region: HMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQM