Antibodies

Jump to Filters
View as table Download
Flotillin 1 (FLOT1) Goat Polyclonal Antibody
TA302489

USD 375.00

5 Days

Goat Polyclonal Antibody against Flotillin 1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SISQVNHKPLRTA, from the C Terminus of the protein sequence according to NP_005794.
Flotillin 1 (FLOT1) Rabbit Polyclonal Antibody
TA338139

USD 375.00

5 Days

Rabbit Polyclonal Anti-FLOT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FLOT1 antibody is: synthetic peptide directed towards the middle region of Human FLOT1. Synthetic peptide located within the following region: IREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAY
Flotillin 1 (FLOT1) Rabbit Polyclonal Antibody
TA338140

USD 375.00

5 Days

Rabbit Polyclonal Anti-FLOT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FLOT1 antibody is: synthetic peptide directed towards the C-terminal region of Human FLOT1. Synthetic peptide located within the following region: QQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLER