Rabbit Polyclonal Anti-Pim-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pim-1 Antibody: A synthesized peptide derived from human Pim-1 |
Rabbit Polyclonal Anti-Pim-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pim-1 Antibody: A synthesized peptide derived from human Pim-1 |
Rabbit polyclonal anti-PIM1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 296 of rat PIM1 |
Rabbit Polyclonal Anti-PIM1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIM1 antibody: synthetic peptide directed towards the N terminal of human PIM1. Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG |
Rabbit Polyclonal Anti-PIM1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIM1 antibody: synthetic peptide directed towards the N terminal of human PIM1. Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG |
Rabbit Polyclonal Anti-PIM1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PIM1 |