Rabbit Polyclonal Anti-CHST6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHST6 antibody: synthetic peptide directed towards the middle region of human CHST6. Synthetic peptide located within the following region: YAFTGLSLTPQLEAWIHNITHGSGPGARREAFKTSSRNALNVSQAWRHAL |
Rabbit Polyclonal Anti-CHST6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHST6 antibody: synthetic peptide directed towards the middle region of human CHST6. Synthetic peptide located within the following region: QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN |
Rabbit polyclonal anti-CHST6 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHST6. |
CHST6 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
