Antibodies

Jump to Filters
View as table Download
AP4B1 Rabbit Polyclonal Antibody
TA332032

USD 375.00

5 Days

Rabbit Polyclonal Anti-AP4B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AP4B1 Antibody is: synthetic peptide directed towards the C-terminal region of Human AP4B1. Synthetic peptide located within the following region: GAERCDPELPKTSSFAASGPLIPEENKERVQELPDSGALMLVPNRQLTAD