Antibodies

View as table Download

Rabbit Polyclonal Anti-DCXR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCXR antibody: synthetic peptide directed towards the middle region of human DCXR. Synthetic peptide located within the following region: STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM

Goat Polyclonal Antibody against DCXR

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GSTLPVEGGFWAC, from the C Terminus of the protein sequence according to NP_057370.1.

Rabbit polyclonal antibody to L-xylulose reductase (dicarbonyl/L-xylulose reductase)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 182 and 244 of DCXR (Uniprot ID#Q7Z4W1)

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated