Antibodies

Jump to Filters
View as table Download
PGD Rabbit Polyclonal Antibody
TA308104

USD 415.00

5 Days

Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209)
PGD Rabbit Polyclonal Antibody
TA313090

USD 345.00

In Stock

Rabbit polyclonal anti-PGD antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PGD.
PGD Rabbit Polyclonal Antibody
TA343269

USD 375.00

5 Days

Rabbit Polyclonal Anti-PGD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGD antibody is: synthetic peptide directed towards the N-terminal region of PGD. Synthetic peptide located within the following region: DFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGE
PGD Mouse Monoclonal Antibody [Clone ID: OTI2A5]
CF505578

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PGD Mouse Monoclonal Antibody [Clone ID: OTI2A5]
TA505578

USD 379.00

In Stock

PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PGD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]
TA505578AM

USD 420.00

5 Days

PGD mouse monoclonal antibody,clone 2A5, Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
PGD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A5]
TA505578BM

USD 420.00

5 Days

PGD mouse monoclonal antibody,clone 2A5, HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
PGD Mouse Monoclonal Antibody [Clone ID: OTI2A5]
TA505578S

USD 159.00

2 Days

PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated