Germany
Japan
United Kingdom
China
USD 345.00
In Stock
Antibodies
View as table Download
USD 450.00
5 Days
Rabbit polyclonal GIPR Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GIPR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-38 amino acids from the N-terminal region of human GIPR. |
USD 450.00
2 Weeks
Gastric Inhibitory Polypeptide Receptor (GIPR) (Center) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 113~142 amino acids from the Center region of Human GIPR. |
USD 425.00
5 Days
Rabbit Polyclonal Anti-GIPR Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GIPR / GIP Receptor antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human GIPR. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Panda, Dog, Bat (94%); Bovine, Rabbit, Horse (89%). |
USD 375.00
5 Days
Rabbit Polyclonal Anti-GIPR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GIPR antibody is: synthetic peptide directed towards the N-terminal region of Human GIPR. Synthetic peptide located within the following region: LRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSVAA |
USD 345.00
In Stock
Rabbit Polyclonal Anti-GIPR Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GIPR |
USD 360.00
5 Days
GIPR Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- GIPR
Pathways
- Neuroactive ligand-receptor interaction