Antibodies

Jump to Filters
View as table Download
POC1B-GALNT4 (N-term) Rabbit Polyclonal Antibody
AP51769PU-N

USD 450.00

2 Weeks

POC1B-GALNT4 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 100-128 amino acids from the N-terminal region of Human GALNT4
GALNT4 Rabbit Polyclonal Antibody
TA338209

USD 375.00

5 Days

Rabbit Polyclonal Anti-GALNT4 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-GALNT4 antibody: synthetic peptide directed towards the middle region of human GALNT4. Synthetic peptide located within the following region: VGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDI
GALNT4 Rabbit Polyclonal Antibody
TA338210

USD 375.00

5 Days

Rabbit Polyclonal Anti-GALNT4 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-GALNT4 antibody: synthetic peptide directed towards the C terminal of human GALNT4. Synthetic peptide located within the following region: ANLSLFGCHGQGGNQFFEYTSNKEIRFNSVTELCAEVPEQKNYVGMQNCP