Antibodies

Jump to Filters
View as table Download
OR52D1 Rabbit Polyclonal Antibody
TA316411

USD 345.00

In Stock

Rabbit polyclonal anti-OR52D1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR52D1.
OR52D1 (C-term) Rabbit Polyclonal Antibody
AP53076PU-N

USD 450.00

2 Weeks

OR52D1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 251-281 amino acids from the C-terminal region of human Olfactory receptor 52D1
OR52D1 Rabbit Polyclonal Antibody
TA334898

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR52D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR52D1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR52D1. Synthetic peptide located within the following region: ALLAMGLDSILIAISYGFILHAVFHLPSHDAQHKALSTCGSHIGIILVFY