Antibodies

Jump to Filters
View as table Download
OR6K2 Rabbit Polyclonal Antibody
TA315850

USD 345.00

4 Weeks

Rabbit polyclonal anti-OR6K2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR6K2.
OR6K2 Rabbit Polyclonal Antibody
TA337536

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR6K2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR6K2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6K2. Synthetic peptide located within the following region: AIALAFAVLSPFFNPIIYSLRNKEIKEAIKKHIGQAKIFFSVRPGTSSKI