Antibodies

Jump to Filters
View as table Download
REC8 Rabbit Polyclonal Antibody
TA346502

USD 475.00

5 Days

Rabbit Polyclonal Anti-REC8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-REC8 antibody: synthetic peptide directed towards the N terminal of human REC8. Synthetic peptide located within the following region: QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN
REC8 Rabbit Polyclonal Antibody
TA315000

USD 345.00

In Stock

Rabbit polyclonal anti-REC8 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human REC8.
REC8 Rabbit Polyclonal Antibody
TA350340

USD 345.00

In Stock

Rabbit Polyclonal Anti-REC8 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human REC8