Antibodies

View as table Download

DERA (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-term region of human DERA

Rabbit Polyclonal Anti-DERA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DERA antibody is: synthetic peptide directed towards the N-terminal region of Human DERA. Synthetic peptide located within the following region: KKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKALN