Rabbit polyclonal anti-RFX5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | RFX5 peptide corresponding to a region at amino acids 320 to 494 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit polyclonal anti-RFX5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | RFX5 peptide corresponding to a region at amino acids 320 to 494 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit Polyclonal Anti-RFX5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFX5 antibody: synthetic peptide directed towards the N terminal of human RFX5. Synthetic peptide located within the following region: MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGIL |
Rabbit Polyclonal Anti-RFX5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFX5 antibody: synthetic peptide directed towards the C terminal of human RFX5. Synthetic peptide located within the following region: VIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDPKATPP |