Antibodies

Jump to Filters
View as table Download
CD40L (CD40LG) Capture Mouse Monoclonal Antibody [Clone ID: MK13A4]
TA600027

USD 379.00

In Stock

CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700027
CD40L (CD40LG) (N-term) Rabbit Polyclonal Antibody
AP23309PU-N

USD 405.00

2 Weeks

CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L
CD40L (CD40LG) Rabbit Polyclonal Antibody
TA334291

USD 375.00

5 Days

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN
CD40L (CD40LG) (C-term) Rabbit Polyclonal Antibody
AP18226PU-N

USD 450.00

2 Weeks

CD40L (CD40LG) (C-term) rabbit polyclonal antibody

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP
CD40L (CD40LG) Mouse Monoclonal Antibody [Clone ID: B-B29]
AM31238FC-N

USD 280.00

2 Weeks

CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, FITC

Applications FC
Reactivities Human
Conjugation FITC
CD40L (CD40LG) Mouse Monoclonal Antibody [Clone ID: B-B29]
AM31238PU-N

USD 250.00

2 Weeks

CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Purified

Applications FC
Reactivities Human
CD40L (CD40LG) Mouse Monoclonal Antibody [Clone ID: B-B29]
AM31238RP-N

USD 300.00

2 Weeks

CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, PE

Applications FC
Reactivities Human
Conjugation PE
CD40L (CD40LG) (N-term) Rabbit Polyclonal Antibody
AP17806PU-N

USD 450.00

2 Weeks

CD40L (CD40LG) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human TRAP
CD40L (CD40LG) Mouse Monoclonal Antibody [Clone ID: 24-31]
TA320280

USD 170.00

5 Days

Mouse Anti-Human CD154 (CD40 Ligand) Purified (25 ug)

Reactivities Human
Conjugation Unconjugated
CD40L (CD40LG) Rabbit Polyclonal Antibody
TA354175

USD 355.00

5 Days

Rabbit anti CD154 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to aa 51-69 of human CD154.
CD40L (CD40LG) Rabbit Polyclonal Antibody
TA349779

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CD40LG
CD40L (CD40LG) Biotinylated Mouse Monoclonal Detection Antibody [Clone ID: MK13A4]
TA700027

USD 399.00

In Stock

CD40L biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone MK13A4

Applications ELISA, LMNX
Reactivities Human
Conjugation Biotin
Matched ELISA Pair TA600027