Antibodies

Jump to Filters
View as table Download
Prion protein PrP (PRNP) Rabbit Polyclonal Antibody
TA332568

USD 275.00

3 Weeks

Rabbit anti-PRNP Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRNP
Prion protein PrP (PRNP) Rabbit Polyclonal Antibody
TA343277

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRNP Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Prnp antibody is: synthetic peptide directed towards the middle region of Mouse Prnp. Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF