Rabbit Anti-Ribosomal S6 kinase 2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH |
Rabbit Anti-Ribosomal S6 kinase 2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH |
Rabbit polyclonal anti-S6K-a2 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human S6K-a2. |
Rabbit Polyclonal Anti-RPS6KA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RPS6KA2 Antibody: synthetic peptide directed towards the middle region of human RPS6KA2. Synthetic peptide located within the following region: LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR |
Carrier-free (BSA/glycerol-free) RPS6KA2 mouse monoclonal antibody,clone OTI2G5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPS6KA2 mouse monoclonal antibody,clone OTI5G2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPS6KA2 mouse monoclonal antibody,clone OTI2H3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPS6KA2 mouse monoclonal antibody,clone OTI2E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPS6KA2 mouse monoclonal antibody,clone OTI2D4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPS6KA2 mouse monoclonal antibody,clone OTI2H10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPS6KA2 mouse monoclonal antibody,clone OTI10F11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPS6KA2 mouse monoclonal antibody,clone OTI3C8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RPS6KA2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RPS6KA2 |
RPS6KA2 mouse monoclonal antibody,clone OTI2G5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI2G5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI2G5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPS6KA2 mouse monoclonal antibody,clone OTI2G5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPS6KA2 mouse monoclonal antibody,clone OTI5G2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI5G2, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI5G2, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPS6KA2 mouse monoclonal antibody,clone OTI5G2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPS6KA2 mouse monoclonal antibody,clone OTI2H3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI2H3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI2H3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPS6KA2 mouse monoclonal antibody,clone OTI2H3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPS6KA2 mouse monoclonal antibody,clone OTI2E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI2E4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI2E4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPS6KA2 mouse monoclonal antibody,clone OTI2E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPS6KA2 mouse monoclonal antibody,clone OTI2D4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI2D4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI2D4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPS6KA2 mouse monoclonal antibody,clone OTI2D4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPS6KA2 mouse monoclonal antibody,clone OTI2H10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI2H10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI2H10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPS6KA2 mouse monoclonal antibody,clone OTI2H10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPS6KA2 mouse monoclonal antibody,clone OTI10F11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI10F11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI10F11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPS6KA2 mouse monoclonal antibody,clone OTI10F11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPS6KA2 mouse monoclonal antibody,clone OTI3C8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI3C8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPS6KA2 mouse monoclonal antibody,clone OTI3C8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPS6KA2 mouse monoclonal antibody,clone OTI3C8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |