Antibodies

View as table Download

PDE4 (PDE4B) (723-736) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide from C-terminus of Human PDE4B

PDE4 (PDE4B) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 196-225 amino acids from the Central region of Human PDE4B

Rabbit Polyclonal Anti-PDE4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE4B Antibody: synthetic peptide directed towards the middle region of human PDE4B. Synthetic peptide located within the following region: QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED

Goat Polyclonal Antibody against Phosphodiesterase 4B

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-DIDIATEDKSPVDT, from the C Terminus of the protein sequence according to NP_002591.2; NP_001032418.1; NP_001032416.1; NP_001032417.1.

Rabbit polyclonal antibody to Phosphodiesterase 4B (phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 489 and 736 of PDE4B (Uniprot ID#Q07343)

Carrier-free (BSA/glycerol-free) PDE4B mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDE4B mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDE4B mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDE4B mouse monoclonal antibody, clone OTI3B12 (formerly 3B12)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDE4B mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDE4B mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDE4B mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDE4B mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PDE4B mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDE4B mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PDE4B mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDE4B mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PDE4B mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PDE4B mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PDE4B mouse monoclonal antibody, clone OTI3B12 (formerly 3B12)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDE4B mouse monoclonal antibody, clone OTI3B12 (formerly 3B12)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PDE4B mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDE4B mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PDE4B mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDE4B mouse monoclonal antibody, clone OTI3A10 (formerly 3A10), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PDE4B mouse monoclonal antibody, clone OTI3A10 (formerly 3A10), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PDE4B mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".