Antibodies

Jump to Filters
View as table Download
SRP68 Rabbit Polyclonal Antibody
TA343802

USD 475.00

5 Days

Rabbit Polyclonal Anti-SRP68 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRP68 antibody: synthetic peptide directed towards the N terminal of human SRP68. Synthetic peptide located within the following region: EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG
SRP68 Rabbit Polyclonal Antibody
TA351671

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-SRP68 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SRP68
SRP68 Rabbit Polyclonal Antibody
TA351672

USD 345.00

In Stock

Rabbit Polyclonal Anti-SRP68 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SRP68