Antibodies

Jump to Filters
View as table Download
Nucleoside phosphorylase (PNP) Rabbit Polyclonal Antibody
TA346671

USD 475.00

5 Days

Rabbit Polyclonal Anti-NP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NP antibody: synthetic peptide directed towards the middle region of human NP. Synthetic peptide located within the following region: GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG
Nucleoside phosphorylase (PNP) Rabbit Polyclonal Antibody
TA332910

USD 275.00

3 Weeks

Rabbit anti-PNP Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PNP