Antibodies

Jump to Filters
View as table Download
POLR1C Rabbit Polyclonal Antibody
TA321959

USD 345.00

4 Weeks

Anti-POLR1C Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 200 amino acids of human polymerase (RNA) I polypeptide C, 30kDa
POLR1C Rabbit Polyclonal Antibody
TA330301

USD 375.00

5 Days

Rabbit Polyclonal Anti-POLR1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POLR1C antibody is: synthetic peptide directed towards the N-terminal region of Human POLR1C. Synthetic peptide located within the following region: VRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA