Antibodies

View as table Download

Rabbit Polyclonal Anti-DCTD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCTD antibody: synthetic peptide directed towards the middle region of human DCTD. Synthetic peptide located within the following region: MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL

DCTD (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human DCTD.