Antibodies

Jump to Filters
View as table Download
AKR1B1 Rabbit Polyclonal Antibody
TA327139

USD 380.00

3 Weeks

AKR1B1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AKR1B1
AKR1B1 Rabbit Polyclonal Antibody
TA346555

USD 475.00

5 Days

Rabbit Polyclonal Anti-AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the N terminal of human AKR1B1. Synthetic peptide located within the following region: ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN
AKR1B1 Rabbit Polyclonal Antibody
TA346556

USD 410.00

5 Days

Rabbit Polyclonal Anti-AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the C terminal of human AKR1B1. Synthetic peptide located within the following region: QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI
AKR1B1 Mouse Monoclonal Antibody [Clone ID: 4G9-B6-F6]
TA346874

USD 380.00

4 Weeks

Mouse Monoclonal AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
AKR1B1 Mouse Monoclonal Antibody [Clone ID: 4G9-B6-F6]
TA346874S

USD 85.00

4 Weeks

Mouse Monoclonal AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
AKR1B1 Rabbit Polyclonal Antibody
TA323139

USD 345.00

In Stock

Anti-AKR1B1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
AKR1B1 Rabbit Polyclonal Antibody
TA323140

USD 345.00

In Stock

Anti-AKR1B1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
AKR1B1 Rabbit Polyclonal Antibody
TA323141

USD 345.00

In Stock

Anti-AKR1B1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 304-316 amino acids of human aldo-keto reductase family 1, member B1 (aldose reductase)
AKR1B1 Rabbit Polyclonal Antibody
TA323142

USD 345.00

In Stock

Anti-AKR1B1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 304-316 amino acids of human aldo-keto reductase family 1, member B1 (aldose reductase)