Antibodies

View as table Download

Rabbit anti-MTR4 Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MTR4

Rabbit Polyclonal Anti-SKIV2L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SKIV2L2 antibody: synthetic peptide directed towards the N terminal of human SKIV2L2. Synthetic peptide located within the following region: KGPPGSADKAGKRFDGKLQSESTNNGKNKRDVDFEGTDEPIFGKKPRIEE