Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against DEAD-box protein 6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AEYHSEPVEDEKP, from the C Terminus of the protein sequence according to NP_004388.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DDX6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: CLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYL |
Rabbit Polyclonal Anti-DDX6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ |
Carrier-free (BSA/glycerol-free) Purified DDX6 mouse monoclonal antibody, clone OTI3B7 (formerly 3B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Purified DDX6 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DDX6 mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Purified DDX6 mouse monoclonal antibody, clone OTI3B7 (formerly 3B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Purified DDX6 mouse monoclonal antibody, clone OTI3B7 (formerly 3B7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Purified DDX6 mouse monoclonal antibody, clone OTI3B7 (formerly 3B7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Purified DDX6 mouse monoclonal antibody, clone OTI3B7 (formerly 3B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Purified DDX6 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Purified DDX6 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Purified DDX6 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Purified DDX6 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- DDX6
Pathways
- RNA degradation