Germany
Japan
United Kingdom
China
Rabbit polyclonal Cytochrome P450 3A43 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A43. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CYP3A43 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the middle region of human CYP3A43. Synthetic peptide located within the following region: ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII |
Rabbit Polyclonal Anti-CYP3A43 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the C terminal of human CYP3A43. Synthetic peptide located within the following region: IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR |
Active filters
Target Symbol
- CYP3A43
Pathways
- Retinol metabolism