Antibodies

View as table Download

Rabbit Polyclonal Anti-RPL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL9 antibody: synthetic peptide directed towards the C terminal of human RPL9. Synthetic peptide located within the following region: GVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIY

Rabbit Polyclonal Anti-RPL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL9 antibody: synthetic peptide directed towards the C terminal of human RPL9. Synthetic peptide located within the following region: ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE

RPL9 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 148-177 amino acids from the C-terminal region of Human RPL9