Antibodies

View as table Download

Rabbit polyclonal anti-MRPL13 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MRPL13.

Rabbit Polyclonal Anti-MRPL13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MRPL13 antibody: synthetic peptide directed towards the middle region of human MRPL13. Synthetic peptide located within the following region: AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD

Carrier-free (BSA/glycerol-free) MRPL13 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MRPL13 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MRPL13 mouse monoclonal antibody,clone 6A11, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

MRPL13 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated