Rabbit Polyclonal Anti-RPL8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL8 antibody: synthetic peptide directed towards the C terminal of human RPL8. Synthetic peptide located within the following region: KKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAM |
Rabbit Polyclonal Anti-RPL8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL8 antibody: synthetic peptide directed towards the C terminal of human RPL8. Synthetic peptide located within the following region: EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN |
Goat Polyclonal Antibody against RPL8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KAGRAYHKYKAKRNC, from the internal region of the protein sequence according to NP_000964.1; NP_150644.1. |
Germany
Japan
United Kingdom
China
