Antibodies

View as table Download

RPS15 (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human RPS15

Rabbit polyclonal anti-RPS15 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPS15.

Rabbit Polyclonal Anti-RPS15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS15 Antibody: synthetic peptide directed towards the middle region of human RPS15. Synthetic peptide located within the following region: GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL