Goat Polyclonal Antibody against TRAF1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KLQSPKHAYVKDD, from the C Terminus of the protein sequence according to NP_005649.1. |
Goat Polyclonal Antibody against TRAF1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KLQSPKHAYVKDD, from the C Terminus of the protein sequence according to NP_005649.1. |
Rabbit Polyclonal Anti-TRAF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRAF1 antibody: synthetic peptide directed towards the middle region of human TRAF1. Synthetic peptide located within the following region: DAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK |
Anti-TRAF1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 182-412 amino acids of human TNF receptor-associated factor 1 |
Anti-TRAF1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 182-412 amino acids of human TNF receptor-associated factor 1 |