Antibodies

View as table Download

Goat Polyclonal Antibody against RXRA

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQVNSSLTSPTGRGSM, from the internal region of the protein sequence according to NP_002948.1.

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF