Antibodies

Jump to Filters
View as table Download
Galactosylceramidase (GALC) Rabbit Polyclonal Antibody
TA336244

USD 375.00

5 Days

Rabbit Polyclonal Anti-GALC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GALC Antibody: synthetic peptide directed towards the middle region of human GALC. Synthetic peptide located within the following region: LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL
Galactosylceramidase (GALC) Rabbit Polyclonal Antibody
TA351208

USD 345.00

In Stock

Rabbit Polyclonal Anti-GALC Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GALC