Antibodies

Jump to Filters
View as table Download
DDX23 Rabbit Polyclonal Antibody
TA341572

USD 310.00

5 Days

Rabbit Polyclonal Anti-DDX23 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX23 antibody: synthetic peptide directed towards the C terminal of human DDX23. Synthetic peptide located within the following region: EDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA
DDX23 Rabbit Polyclonal Antibody
TA355829

USD 360.00

5 Days

DDX23 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated