Antibodies

View as table Download

Rabbit Polyclonal Anti-SNRPA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPA antibody: synthetic peptide directed towards the middle region of human SNRPA. Synthetic peptide located within the following region: MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV

U1A (SNRPA) mouse monoclonal antibody, clone 3F9-1F7

Applications ELISA, IF, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-SNRPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPA antibody: synthetic peptide directed towards the N terminal of human SNRPA. Synthetic peptide located within the following region: MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLK

U1A (SNRPA) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 82-111 amino acids from the Central region of human SNRPA